PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA11G16350.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 380aa    MW: 43105.8 Da    PI: 9.892
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA11G16350.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B354.22.6e-1721971698
                     EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
               B3 16 lvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                     + +p +f  ++ ++++++  +++l d+sg++W+ +l  +  s+++++  GWkeFv++n ++ g f+vF++d+rs+f   v+vf+
  ONIVA11G16350.2 21 MKIPSSFN-QClQNQPTG--MVSLVDRSGNKWSAEL--TSDSEGFFFVHGWKEFVRDNSIQCGQFLVFTYDKRSQF--SVTVFE 97
                     78999997.554666665..8***************..*********************************99999..888876 PP

2B352.59.2e-17274365398
                      EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      ++++ s+v     + +p +f++e+   ++++k +tl d++g+ Wev++ y   ++   +++GW +F+  n+L+  D++vF+l+++++   +v++
  ONIVA11G16350.2 274 QIMMESYVYVGFFMNIPCEFVRECL--PRTNKRITLWDPQGKAWEVNYVYYSDRSVGSFSGGWGKFAVGNNLEKFDVCVFELVQKDN--IKVHI 363
                      6789999999**************5..345678***************995555556799*********************998444..57887 PP

                      E- CS
               B3  97 fr 98 
                      +r
  ONIVA11G16350.2 364 YR 365
                      76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010193.6E-7699IPR003340B3 DNA binding domain
PROSITE profilePS5086314.311699IPR003340B3 DNA binding domain
SuperFamilySSF1019361.31E-2020103IPR015300DNA-binding pseudobarrel domain
CDDcd100172.78E-152196No hitNo description
PfamPF023622.8E-152196IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.6E-192199IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.1E-26264365IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.44E-25265365IPR015300DNA-binding pseudobarrel domain
CDDcd100171.13E-23270365No hitNo description
SMARTSM010195.0E-15272367IPR003340B3 DNA binding domain
PROSITE profilePS5086313.352272367IPR003340B3 DNA binding domain
PfamPF023626.4E-15274365IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MDWRKNREVG RSRREEERVV MKIPSSFNQC LQNQPTGMVS LVDRSGNKWS AELTSDSEGF  60
FFVHGWKEFV RDNSIQCGQF LVFTYDKRSQ FSVTVFEPSG IDKISTFSAH PSKNVIIKTE  120
SDEGGMVTAA ITTEKMAPAL KENNGITGKR TRDVDYLMED RVVVFKKSSE ANVCESSRRK  180
RAGASAGKSK VTSTSHNSTR GSSCSSDEDN SSSKSPNPPF LMRFLSGEVS RRGVSKGQRQ  240
LTVISQRRPV TEAEKDHALQ RAREFKSKNP FAVQIMMESY VYVGFFMNIP CEFVRECLPR  300
TNKRITLWDP QGKAWEVNYV YYSDRSVGSF SGGWGKFAVG NNLEKFDVCV FELVQKDNIK  360
VHIYRVVPEI TPHKLRSDPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1324536622142B3 domain-containing transcription factor VRN
4i1k_B2e-1324536622142B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1019410.0AK101941.1 Oryza sativa Japonica Group cDNA clone:J033074I03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615373.10.0PREDICTED: B3 domain-containing protein Os11g0197600
SwissprotQ2R9D20.0Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A0E0J3270.0A0A0E0J327_ORYNI; Uncharacterized protein
STRINGBGIOSGA034352-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42700.13e-19B3 family protein